PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.18637s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 422aa    MW: 47155.5 Da    PI: 6.4451
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.18637s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.22.8e-31212266155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+r+rWtpeLHe+Fv+ v +L G+ekAtPk++++lm+v+gLt++hvkSHLQkYRl
  Araha.18637s0001.1.p 212 KTRMRWTPELHESFVKSVIKLEGPEKATPKAVMKLMNVEGLTIYHVKSHLQKYRL 266
                           68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-29209267IPR009057Homeodomain-like
SuperFamilySSF466896.63E-16211266IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-22212267IPR006447Myb domain, plants
PfamPF002491.2E-7214265IPR001005SANT/Myb domain
PfamPF143793.2E-22302349IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MNRHSLVSTA TDECNKGVGQ TCSTSPSPVH NFLNVRPEHR KSPFIRSQSP DSTGQLWPKN  60
ISQSTFSRSS TFCTNLYLSS SSTSETQKHL GNSLPFLPDP SSYTHSASGV ESARSPSIFS  120
EDLGNQCDGD NSGSLLKDFL NLSGDACSDG GFHDFGCSND SFCLSDQMEL QFLSDELELA  180
ITDRAETPRL DEIYETPLAS SNPVTRLTAN NKTRMRWTPE LHESFVKSVI KLEGPEKATP  240
KAVMKLMNVE GLTIYHVKSH LQKYRLAKYM PEKKEEKKNE NSEEKKLALS NSDADEKKKG  300
AIQLTEALRM QMEVQKQLHE QLEVQRVLQL RIEEHAKYLE KMLEEQRKTG KLICSSSSQT  360
VLSPSDDSIS DSQNMSKTEA SSPQRSTSAK NKASETEDDK CESPQKRRRL ENKAESEDPK  420
R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1405409KRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0508890.0AY050889.1 Arabidopsis thaliana unknown protein (At3g13040) mRNA, complete cds.
GenBankAY0966740.0AY096674.1 Arabidopsis thaliana unknown protein (At3g13040) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002884938.10.0hypothetical protein ARALYDRAFT_478672
TrEMBLD7L0M90.0D7L0M9_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.3__1373__AT3G13040.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67862744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.20.0G2-like family protein